TMEM123 ORF clone

Services

Gene ID: 114908

Synonym(s): KCT3, PORIMIN, PORMIN

Description: This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death. [provided by RefSeq, Jul 2008].

This ORF sequence encodes a protein that is exactly the same as the protein of NM_052932. The protein has 11 functional sites and/or regions.

Product Details

Clone Vector	pCT-AAV-CMV-MCS vector
Species	Human
Promotor for Target Gene	CMV
Target Gene Name	TMEM123
Target Gene Position	Inserted between PacI and AscI
ORF Length	624
Protein Length	208
Native Stop Codon	False
ORF Sequence	atgggactcggcgcgcgaggtgcttgggccgcgctgctcctggggacgctgcaggtgctagcgctgctgggggccgcccatgaaagcgcagccatggcggcatctgcaaacatagagaattctgggcttccacacaactccagtgctaactcaacagagactctccaacatgtgccttctgaccatacaaatgaaacttccaacagtactgtgaaaccaccaacttcagttgcctcagactccagtaatacaacggtcaccaccatgaaacctacagcggcatctaatacaacaacaccagggatggtctcaacaaatatgacttctaccaccttaaagtctacacccaaaacaacaagtgtttcacagaacacatctcagatatcaacatccacaatgaccgtaacccacaatagttcagtgacatctgctgcttcatcagtaacaatcacaacaactatgcattctgaagcaaagaaaggatcaaaatttgatactgggagctttgttggtggtattgtattaacgctgggagttttatctattctttacattggatgcaaaatgtattactcaagaagaggcattcggtatcgaaccatagatgaacatgatgccatcatt
Protein Sequence	MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII
Functional Site/Region	Region at 42-125, Disordered., seq too large to show; Site at 46-46, glycosylation, seq=N; Site at 50-50, glycosylation, seq=N; Site at 64-64, glycosylation, seq=N; Site at 68-68, glycosylation, seq=N; Site at 83-83, glycosylation, seq=N; Site at 96-96, glycosylation, seq=N; Site at 106-106, glycosylation, seq=N; Site at 124-124, glycosylation, seq=N; Site at 138-138, glycosylation, seq=N; Site at 167-187, transmembrane region, seq=GSFVGGIVLTLGVLSILYIGC;

Serotype	Targeting Tissues
1	Central Nervous System, Heart, Retinal Pigment Epithelium, Skeletal Muscle
2	Central Nervous System, Kidney, Photoreceptor Cells, Retinal Pigment Epithelium
5	Central Nervous System, Lung, Photoreceptor Cells, Retinal Pigment Epithelium
7	Liver, Skeletal Muscle
8	Central Nervous System, Heart, Liver, Pancreas, Photoreceptor Cells, Retinal Pigment Epithelium
9	Central Nervous System, Heart, Liver, Lung, Skeletal Muscle
RH10	Central Nervous System, Liver, Skeletal Muscle, Lung

User Instructions | pCT-AAV-CMV-ORF Vector Map | Materials Safety Data Sheet

Catalog Number	Product	Size	Price	Qty
ET-107035-AAV-1-50	TMEM123 rAAV Virus Particles (Serotype 1)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-1-200	TMEM123 rAAV Virus Particles (Serotype 1)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-2-50	TMEM123 rAAV Virus Particles (Serotype 2)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-2-200	TMEM123 rAAV Virus Particles (Serotype 2)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-5-50	TMEM123 rAAV Virus Particles (Serotype 5)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-5-200	TMEM123 rAAV Virus Particles (Serotype 5)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-7-50	TMEM123 rAAV Virus Particles (Serotype 7)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-7-200	TMEM123 rAAV Virus Particles (Serotype 7)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-8-50	TMEM123 rAAV Virus Particles (Serotype 8)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-8-200	TMEM123 rAAV Virus Particles (Serotype 8)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-9-50	TMEM123 rAAV Virus Particles (Serotype 9)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-9-200	TMEM123 rAAV Virus Particles (Serotype 9)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-RH10-50	TMEM123 rAAV Virus Particles (Serotype RH10)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-107035-AAV-RH10-200	TMEM123 rAAV Virus Particles (Serotype RH10)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-107035-AAV-pd	TMEM123 pAAV-CMV-ORF TRANSFER VECTOR (Plasmid), Glycerol Stock	1 vial	Price: $1,200.00	Quantity

Products

Services

TMEM123 Full-Length ORF: Human Gene AAV Virus

Shopping Cart: 0 Items

Your Wishlist: 0 Items